PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10002559
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 366aa    MW: 41461.3 Da    PI: 6.9956
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10002559genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.34.9e-152168148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l ++    G g+W+ +a+  g+ R++k+c++rw +yl
      Lus10002559 21 KGLWSPEEDEKLMNYMMSNGQGCWSDVAKNAGLQRCGKSCRLRWINYL 68
                     678*******************************************97 PP

2Myb_DNA-binding51.52.4e-1674117146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++ +E++l+v+++ +lG++ W+ Ia++m+ gRt++++k++w++
      Lus10002559  74 RGAFSSQEEDLIVHLHSLLGNR-WSQIAARMP-GRTDNEIKNFWNS 117
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-231571IPR009057Homeodomain-like
PROSITE profilePS5129415.8921668IPR017930Myb domain
SuperFamilySSF466894.69E-2819115IPR009057Homeodomain-like
SMARTSM007173.9E-112070IPR001005SANT/Myb domain
PfamPF002493.6E-142168IPR001005SANT/Myb domain
CDDcd001671.77E-92468No hitNo description
PROSITE profilePS5129424.58169123IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.2E-2472122IPR009057Homeodomain-like
SMARTSM007177.5E-1573121IPR001005SANT/Myb domain
PfamPF002491.4E-1474117IPR001005SANT/Myb domain
CDDcd001674.61E-1076116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MRKPEAKTTS SNSSTTTKVR KGLWSPEEDE KLMNYMMSNG QGCWSDVAKN AGLQRCGKSC  60
RLRWINYLRP DLKRGAFSSQ EEDLIVHLHS LLGNRWSQIA ARMPGRTDNE IKNFWNSTIK  120
KRQKSMSSSS TSPNTSDHSS MEPNKDHTMG VPPPNSLSSR TIFMEPPMFI DESSLTSLQI  180
LEDQQYHHHH HGLMNMYGHA NPYLMAPLAS MVDDHHGVSS YGLDQGFFEK DIQVLPPLTE  240
SMAIDGAHDN IRCTNHGRYS RDQSEFASTM PSSVSDFLVA KHNIDVSTNN NKYQMLNSTN  300
NKYQLLNGTN NNMSNNKIKN NIMGSFWQGD HQIQDHVLSS TKVGEWDFEE LMKDVSSFPF  360
LDFQN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-262112227127MYB TRANSFORMING PROTEIN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.16e-69myb domain protein 46